DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34351 and Rgs9bp

DIOPT Version :9

Sequence 1:NP_001260044.1 Gene:CG34351 / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001102612.1 Gene:Rgs9bp / 499132 RGDID:1561747 Length:237 Species:Rattus norvegicus


Alignment Length:50 Identity:14/50 - (28%)
Similarity:26/50 - (52%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LIVEINSHVALFRDMLIHVGQAKDCPELREKIRKLRRTCVEALKHTAQIL 79
            |:..:|...|.:..:::.||.:.|..:|||:::|.|:...|....|...|
  Rat     9 LLDALNKTTACYHHLVLTVGGSADTQDLREELQKTRQKARELAMATGSRL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34351NP_001260044.1 Syntaxin_2 27..>77 CDD:291208 13/46 (28%)
Rgs9bpNP_001102612.1 Syntaxin_2 7..104 CDD:291208 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21029
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.