powered by:
Protein Alignment CG34351 and Rgs9bp
DIOPT Version :9
Sequence 1: | NP_001260044.1 |
Gene: | CG34351 / 5740672 |
FlyBaseID: | FBgn0085380 |
Length: | 233 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102612.1 |
Gene: | Rgs9bp / 499132 |
RGDID: | 1561747 |
Length: | 237 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 14/50 - (28%) |
Similarity: | 26/50 - (52%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 LIVEINSHVALFRDMLIHVGQAKDCPELREKIRKLRRTCVEALKHTAQIL 79
|:..:|...|.:..:::.||.:.|..:|||:::|.|:...|....|...|
Rat 9 LLDALNKTTACYHHLVLTVGGSADTQDLREELQKTRQKARELAMATGSRL 58
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166346566 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR21029 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.