DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34351 and RGS7BP

DIOPT Version :9

Sequence 1:NP_001260044.1 Gene:CG34351 / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001025046.1 Gene:RGS7BP / 401190 HGNCID:23271 Length:257 Species:Homo sapiens


Alignment Length:241 Identity:55/241 - (22%)
Similarity:96/241 - (39%) Gaps:56/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RGSTAVELDK----ITNLNTLIVEINSHVALFRDMLIHVGQAK-DCPELREKIRKLRRTCVEALK 73
            |||.:....|    :.:...|:.|.|:.|||:|:::|.:|... .||.||.::.|.|....|..:
Human    36 RGSGSESAHKTQRALDDCKMLVQEFNTQVALYRELVISIGDVSVSCPSLRAEMHKTRTKGCEMAR 100

  Fly    74 HTAQILMPQVKSAMADGILTDNPHLVLLFYMAQ----LFLRELVKSYRLIQVVPMDMSGYYENRA 134
            ...|.|  ...|...||.:  :|.:..|:...|    ::..|::||..|:..:.....| .|...
Human   101 QAHQKL--AAISGPEDGEI--HPEICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKG-KEPGG 160

  Fly   135 GPSNLGNVISQILLCK-------------------------QFTPDFNEEELCSITKDSQDIAVL 174
            |..:|.        ||                         |.:.|....|     :|.:::..|
Human   161 GTKSLD--------CKIEESAETPALEDSSSSPVDSQQHSWQVSTDIENTE-----RDMREMKNL 212

  Fly   175 LAEMQEYMPQHEAYLERNAALDTTGPWQAKRRQNYICKNMSLLCCV 220
            |::::|.||......:.::.|:.| |:...||:.   :....|||:
Human   213 LSKLRETMPLPLKNQDDSSLLNLT-PYPLVRRRK---RRFFGLCCL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34351NP_001260044.1 Syntaxin_2 27..>77 CDD:291208 16/50 (32%)
RGS7BPNP_001025046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..196 1/21 (5%)
Nuclear localization signal. /evidence=ECO:0000250 242..247 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.