DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dcma and RGS9BP

DIOPT Version :10

Sequence 1:NP_001260044.1 Gene:dcma / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_997274.2 Gene:RGS9BP / 388531 HGNCID:30304 Length:235 Species:Homo sapiens


Alignment Length:41 Identity:11/41 - (26%)
Similarity:23/41 - (56%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LIVEINSHVALFRDMLIHVGQAKDCPELREKIRKLRRTCVE 70
            |:..:|...|.:..:::.||.:.|...||::::|.|:...|
Human     9 LLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQE 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcmaNP_001260044.1 Syntaxin_2 27..>77 CDD:464199 11/41 (27%)
C_NRPS-like <38..123 CDD:394795 9/33 (27%)
RGS9BPNP_997274.2 SNARE-like. /evidence=ECO:0000250 153..200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.