| Sequence 1: | NP_001260044.1 | Gene: | dcma / 5740672 | FlyBaseID: | FBgn0085380 | Length: | 233 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_997274.2 | Gene: | RGS9BP / 388531 | HGNCID: | 30304 | Length: | 235 | Species: | Homo sapiens |
| Alignment Length: | 41 | Identity: | 11/41 - (26%) |
|---|---|---|---|
| Similarity: | 23/41 - (56%) | Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 LIVEINSHVALFRDMLIHVGQAKDCPELREKIRKLRRTCVE 70 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dcma | NP_001260044.1 | Syntaxin_2 | 27..>77 | CDD:464199 | 11/41 (27%) |
| C_NRPS-like | <38..123 | CDD:394795 | 9/33 (27%) | ||
| RGS9BP | NP_997274.2 | SNARE-like. /evidence=ECO:0000250 | 153..200 | ||
| Blue background indicates that the domain is not in the aligned region. | |||||