DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34351 and rgs7bpb

DIOPT Version :9

Sequence 1:NP_001260044.1 Gene:CG34351 / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001025240.1 Gene:rgs7bpb / 337556 ZFINID:ZDB-GENE-030131-9502 Length:251 Species:Danio rerio


Alignment Length:218 Identity:58/218 - (26%)
Similarity:104/218 - (47%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TLIVEINSHVALFRDMLIHVGQ-AKDCPELREKIRKLR-RTCV---EALKHTAQILMPQVKSAMA 88
            |.:.|.|:.|||.|:.:|.:|: ..|||.||.::.|.| :.|.   .|.::...|..|:      
Zfish    50 TTVQEFNTLVALHREQVISIGENTTDCPSLRAQMHKTRVKGCAVAQAAYQNLIAISGPE------ 108

  Fly    89 DGILTDNPHLVLLFYMAQ----LFLRELVKSYRLIQVVPMDMSGYYENRAGPS-NLGNVISQ--- 145
            ||.:  :|.:..||...|    :::.|::||..|:.|:.:...|   |...|. |:...:.:   
Zfish   109 DGEI--HPEICRLFIQLQCCLEMYITEMLKSMCLLGVLQLHRKG---NDMCPELNMDCRVDESSD 168

  Fly   146 --ILLCKQFTP-DFNEEE--LC----SITKDSQDIAVLLAEMQEYMPQHEAYLERNAALDTTGPW 201
              :|..:..:| ||.::.  :|    :|..|.:::..||::::|.||......:.::.|:.| |:
Zfish   169 VPMLEDRSSSPMDFPQDSWVVCADIENIESDMREMRNLLSKLRETMPLPLKNQDDSSLLNLT-PY 232

  Fly   202 ----QAKRRQNYICKNMSLLCCV 220
                |.|||       .|.|||:
Zfish   233 PLVRQRKRR-------FSGLCCL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34351NP_001260044.1 Syntaxin_2 27..>77 CDD:291208 18/52 (35%)
rgs7bpbNP_001025240.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.