DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34351 and CG14340

DIOPT Version :9

Sequence 1:NP_001260044.1 Gene:CG34351 / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_608567.2 Gene:CG14340 / 33287 FlyBaseID:FBgn0031302 Length:264 Species:Drosophila melanogaster


Alignment Length:211 Identity:107/211 - (50%)
Similarity:144/211 - (68%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LIVEINSHVALFRDMLIHVGQAKDCPELREKIRKLRRTCVEALKHTAQILMPQVKSAMADGILTD 94
            ||.|||.:||.||::||.:|||:|.||||||||||||:||:|.||||.::.||.:..:  |..::
  Fly    56 LITEINCYVAQFRELLIFIGQARDSPELREKIRKLRRSCVDACKHTAHLITPQPRHCL--GSPSE 118

  Fly    95 NPHLVLLFYMAQLFLRELVKSYRLIQVVPMDMSGYY-ENRAGPSNLGNVISQILLCKQFTPDFNE 158
            ..||.||:::...|..||:||:||||:||:||:.|| .:|..||||||||||.|||||..|||.:
  Fly   119 RMHLTLLYHLTLQFQHELIKSHRLIQLVPLDMTEYYAPSRTAPSNLGNVISQFLLCKQINPDFQQ 183

  Fly   159 EELCSITKDSQDIAVLLAEMQEYMPQHEAYLERNAALD------------TTGPWQAKRRQNYIC 211
            ||||||.||||:::.||.|:|.:||..||..|.:  ||            .|..|.|::|:. .|
  Fly   184 EELCSIVKDSQELSELLEELQAHMPLTEASPEFD--LDPTQKSESSLVSLNTPDWYARQRRR-SC 245

  Fly   212 K--NMSLLCCVSRPNY 225
            |  :.||.||::|.::
  Fly   246 KSRSRSLCCCLARKSH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34351NP_001260044.1 Syntaxin_2 27..>77 CDD:291208 33/46 (72%)
CG14340NP_608567.2 Syntaxin_2 55..145 CDD:291208 49/90 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457916
Domainoid 1 1.000 45 1.000 Domainoid score I12149
eggNOG 1 0.900 - - E1_2CWW8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.