DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34351 and Rgs7bp

DIOPT Version :9

Sequence 1:NP_001260044.1 Gene:CG34351 / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001012347.1 Gene:Rgs7bp / 294715 RGDID:1309360 Length:257 Species:Rattus norvegicus


Alignment Length:233 Identity:56/233 - (24%)
Similarity:99/233 - (42%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RGSTAVELDK----ITNLNTLIVEINSHVALFRDMLIHVGQAK-DCPELREKIRKLRRTCVEALK 73
            |||.:....|    :.:...|:.|.|:.|||:|:::|.:|... .||.||.::.|.|....|..:
  Rat    36 RGSGSESAHKTQRALDDCKMLVQEFNTQVALYRELVISIGDVSVSCPSLRAEMHKTRTKGCEMAR 100

  Fly    74 HTAQILMPQVKSAMADGILTDNPHLVLLFYMAQ----LFLRELVKSYRLIQVVPMDMSGYYENRA 134
            ...|.|  ...|...||.:  :|.:..|:...|    ::..|::||..|:..:.....| .|...
  Rat   101 QAHQKL--AAISGPEDGEI--HPEICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKG-KEASG 160

  Fly   135 GPSNLGNVISQILLCKQFTPDFNEEELCS-----------------ITKDSQDIAVLLAEMQEYM 182
            |..:|.:.|.:    ...||.. |:.|.|                 ..:|.:::..||::::|.|
  Rat   161 GAKSLDSKIEE----NAETPAL-EDSLSSPLDSQQQSWQVATDIENTERDMREMKNLLSKLRETM 220

  Fly   183 PQHEAYLERNAALDTTGPWQAKRRQNYICKNMSLLCCV 220
            |......:.::.|:.| |:...||:.   :....|||:
  Rat   221 PLPLKNQDDSSLLNLT-PYPMVRRRK---RRFFGLCCL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34351NP_001260044.1 Syntaxin_2 27..>77 CDD:291208 16/50 (32%)
Rgs7bpNP_001012347.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..191 5/19 (26%)
Nuclear localization signal. /evidence=ECO:0000250 242..247 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21029
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.