powered by:
Protein Alignment CG34351 and rsbp-1
DIOPT Version :9
Sequence 1: | NP_001260044.1 |
Gene: | CG34351 / 5740672 |
FlyBaseID: | FBgn0085380 |
Length: | 233 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492439.1 |
Gene: | rsbp-1 / 172729 |
WormBaseID: | WBGene00011531 |
Length: | 171 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 18/63 - (28%) |
Similarity: | 35/63 - (55%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 LNTLIVEINSHVALFRDMLIHVGQAKDCPELREKIRKLRRTCVEALKHTAQILMPQVKSAMAD 89
:..|:.|.|..:||||.....:|.|:|...||.::....|.|.:|::....:::||:::..|:
Worm 12 IQELVHECNVQLALFRVATQGIGTAQDGASLRREVETAGRACQKAVEAANNVVLPQLRADEAE 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34351 | NP_001260044.1 |
Syntaxin_2 |
27..>77 |
CDD:291208 |
15/49 (31%) |
rsbp-1 | NP_492439.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_119255 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR21029 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.