DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and Cfap161

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_083611.2 Gene:Cfap161 / 75556 MGIID:1922806 Length:303 Species:Mus musculus


Alignment Length:292 Identity:81/292 - (27%)
Similarity:140/292 - (47%) Gaps:34/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTII-FG-AI 77
            :.|.||:|||.|:..|||:::.:|.::|::||||:::.|.:..|..:.:.|:..:...: :| .:
Mouse     6 YGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKV 70

  Fly    78 VQLMPIHI---NISDMDTTDLNAALSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSG 139
            :.:.|..:   ........||:..:|.  :|...:.|..:...|.:|...:..|..||:|.|:| 
Mouse    71 IIVNPDQVLGEEAGKFMRGDLSLCMSP--DEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILS- 132

  Fly   140 DGRD--RTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNG--ELNLNLGL 200
            ||.:  ..|:.:.|||.|.|...|.....::..:...|..|:.       |.|:|  |:.|...:
Mouse   133 DGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKS-------SLKSGLQEVTLTDEV 190

  Fly   201 VHRSKLSCPDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSPLVIVHATTNRNLAA-ENVLIQT 264
            .|   |:|           |....::|:.|.|.||..:.:|..:||.|..|||.||. .|:.::|
Mouse   191 TH---LNC-----------WQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLRT 241

  Fly   265 LFGPEFLVSVQNYRNIYRHEIWKNVWMISNGH 296
            .||.|..|....|.:.::.|..||.||:..|:
Mouse   242 YFGKEMEVVAHTYLDSHKVEKPKNQWMLVTGN 273



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849881
Domainoid 1 1.000 96 1.000 Domainoid score I7329
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12605
Inparanoid 1 1.050 96 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56406
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008126
OrthoInspector 1 1.000 - - otm42373
orthoMCL 1 0.900 - - OOG6_104967
Panther 1 1.100 - - O PTHR24274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5257
SonicParanoid 1 1.000 - - X6078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.