DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:219 Identity:49/219 - (22%)
Similarity:79/219 - (36%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPCRVGDMDSISARFQPSVRIGNWV--EENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEI 63
            :|.:|...|.||.:...|:....||  ..:|.:.      :.|...||             |...
Mouse    35 VPYQVSLNDGISHQCGGSLISDQWVLSAAHCYKR------RLQVRLGE-------------HNID 80

  Fly    64 VLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCELSVAPSKRP 128
            ||...:|.|....|::    |.:. :.||.| |..:.:.:....:..||........|.|.:...
Mouse    81 VLEGGEQFIDAEKIIR----HPDY-NKDTVD-NDIMLIKLKSPAILNSQVSTVSLPRSCASTNAQ 139

  Fly   129 CVRNSFKIVSGDGRDRTGENIKYGQRFQ--LQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKN 191
            |      :|||     .|..:..|.::.  |||:.:   |::..|..|:         :|    .
Mouse   140 C------LVSG-----WGNTVSIGGKYPALLQCLEA---PVLSASSCKK---------SY----P 177

  Fly   192 GELNLN---LGLVHRSKLSCPDND 212
            |::..|   ||.:...|.|| |.|
Mouse   178 GQITSNMFCLGFLEGGKDSC-DGD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 49/219 (22%)
Tryp_SPc 24..243 CDD:238113 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.