DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:239 Identity:44/239 - (18%)
Similarity:73/239 - (30%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EEDKIV-NFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTD 94
            ::|||| .:..||:.....|    :|...:|.........|.::..|......|.:.:.:.:...
Mouse    21 DDDKIVGGYTCQRNALPYQV----SLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDA 81

  Fly    95 LNAALSVVINEKVVR----KSQSINEDCEL-------------SVAPSKRPCVRNSFK-IVSGDG 141
            |......:...|::|    .:.:.|.|..|             |.....|.|.....: :|||  
Mouse    82 LEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPSAGTRCLVSG-- 144

  Fly   142 RDRTGENIKYGQRFQ--LQCMASEHDPIV----------------------LYSGPKRCNLQQGV 182
               .|..:..|..:.  |||:.:   |::                      |..|...|....|.
Mouse   145 ---WGNTLSSGTNYPSLLQCLDA---PVLSDSSCTSSYPGKITSNMFCLGFLEGGKDSCQGDSGG 203

  Fly   183 HATYLSHKNGELNLNLGLVHRSKLSCPDNDIPIAYTNWFCRHVN 226
            .........|.::...|...|.|        |..||. .|::||
Mouse   204 PVVCNGQLQGVVSWGYGCAQRGK--------PGVYTK-VCKYVN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 43/236 (18%)
Tryp_SPc 25..243 CDD:238113 42/235 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.