DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and prss1

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:165 Identity:39/165 - (23%)
Similarity:62/165 - (37%) Gaps:37/165 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HKEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCELSVAP 124
            |...|....:|.|....:::....:.|..|.|...:..:.|..||..|  |:.|:...|    |.
Zfish    77 HNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYV--KTVSLPSSC----AS 135

  Fly   125 SKRPCVRNSFKIVSGDGR-DRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLS 188
            |...|      ::||.|. ..:|.|  |..|  |.|:   :.||:..|             |..:
Zfish   136 SGTSC------LISGWGNMSASGSN--YPSR--LMCL---NAPILSDS-------------TCRN 174

  Fly   189 HKNGELNLNL---GLVHRSKLSCP-DNDIPIAYTN 219
            ...|:::.|:   |.:...|.||. |:..|:...|
Zfish   175 AYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 39/165 (24%)
Tryp_SPc 25..243 CDD:238113 39/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.