DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and LOC5667668

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_001689377.3 Gene:LOC5667668 / 5667668 VectorBaseID:AGAMI1_010921 Length:272 Species:Anopheles gambiae


Alignment Length:44 Identity:14/44 - (31%)
Similarity:18/44 - (40%) Gaps:9/44 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DIPI-----AYTNWFCRHVNPKQRFESE-GEDI---PSNSPLVI 246
            |||:     ..::|....|.|.....|| |.|.   .|..|||:
Mosquito   188 DIPVVDQAACESSWGSGWVTPDMICASEPGRDACNGDSGGPLVV 231

Return to query results.
Submit another query.