DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and PRSS1

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:165 Identity:30/165 - (18%)
Similarity:49/165 - (29%) Gaps:62/165 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LNAALSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIKYGQRFQLQC 159
            |.:..|.||::|                 ||:..|.|                    |....:||
Human    11 LGSVFSAVISQK-----------------PSRDICQR--------------------GTSLTIQC 38

  Fly   160 MASEHDPIVLY--SGPKR-----CNLQQGVHATYLSHKNGEL---------NLNLGLVHRSKLSC 208
            .......::.:  ..|.:     ....||..|||   ::|.:         ||....:..|.:|.
Human    39 QVDSQVTMMFWYRQQPGQSLTLIATANQGSEATY---ESGFVIDKFPISRPNLTFSTLTVSNMSP 100

  Fly   209 PDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSP 243
            .|:.|      :.|...:..:..:...|..|..||
Human   101 EDSSI------YLCSVEDTVRGTDQRSEQEPQLSP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
PRSS1XP_011514713.1 Ig 19..119 CDD:299845 23/145 (16%)
IG_like 29..113 CDD:214653 18/112 (16%)
Tryp_SPc 248..464 CDD:214473
Tryp_SPc 249..467 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.