DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and zgc:92590

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:223 Identity:47/223 - (21%)
Similarity:79/223 - (35%) Gaps:69/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNF--HKEIVLAAPKQTIIFGAIVQL 80
            :|.:|   |.|...|:.    .:||.:.|.::...:  |:::  ..:.:|...|:..:|...||.
Zfish    71 TVHLG---EHNVAVEEG----TEQRIKAEKVIPHPK--YNDYTLDNDFMLIKLKEPAVFNQYVQP 126

  Fly    81 MPIHINISDMDTTDLNAALSVVINEKVVRKS--QSINEDCELSVAPSKRPC--------VRNSF- 134
            :|:..:.|......|.:....:||..||...  |.:|    |.|. ::..|        .:|.| 
Zfish   127 VPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLN----LPVL-TRAQCEGAYGWQITKNMFC 186

  Fly   135 -KIVSGDGRDRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNL 198
             ..:.| |:|              .|......|::       |              ||||.   
Zfish   187 AGFMEG-GKD--------------ACQGDSGGPVI-------C--------------NGELR--- 212

  Fly   199 GLVHRSKLSCPDNDIPIAYTNWFCRHVN 226
            |:|... ..|.|:..|..||. .||:.:
Zfish   213 GVVSWG-YGCADSGYPGVYTE-VCRYTD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 47/223 (21%)
Tryp_SPc 21..243 CDD:238113 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.