DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG15498

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:278 Identity:134/278 - (48%)
Similarity:190/278 - (68%) Gaps:4/278 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTIIFGAIVQ 79
            :.|.|::|||:|....||.::...||:|:.|.||:::.|.:||.|::..||..|:..:.||.:||
  Fly     2 YGPGVKVGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGTVLGPPQDVLAFGVVVQ 66

  Fly    80 LMPIHINISDMDTTDLNAALSVVI-NEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRD 143
            :.|:.|.:.....:|.|..||||| .|.:.|..::|||.|:|:||||.||.:||||:|||.:..|
  Fly    67 IRPVKIGVCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTVAPSPRPALRNSFRIVSPNEDD 131

  Fly   144 RTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGLVHRSKLSC 208
            |||:.:.||::|:||.:....:|:.::|||||.||...|...:.:.||||:.|.||||  |..:|
  Fly   132 RTGQYLAYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLV--SHKNC 194

  Fly   209 -PDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSPLVIVHATTNRNLAAENVLIQTLFGPEFLV 272
             |...:|.::|::||.|.:|..||||||:.||.::|||||||.||||||.||||..|||||||.|
  Fly   195 GPSARVPTSHTHFFCAHKDPDLRFESEGKTIPVHNPLVIVHAVTNRNLAVENVLANTLFGPEFQV 259

  Fly   273 SVQNYRNIYRHEIWKNVW 290
            |||.|:|:|:.|.|||:|
  Fly   260 SVQTYKNVYKRETWKNLW 277



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470064
Domainoid 1 1.000 97 1.000 Domainoid score I7203
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H12605
Inparanoid 1 1.050 97 1.000 Inparanoid score I5028
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404512at33208
OrthoFinder 1 1.000 - - FOG0008126
OrthoInspector 1 1.000 - - otm26284
orthoMCL 1 0.900 - - OOG6_104967
Panther 1 1.100 - - P PTHR24274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5257
SonicParanoid 1 1.000 - - X6078
1312.830

Return to query results.
Submit another query.