DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and Try10

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:191 Identity:45/191 - (23%)
Similarity:71/191 - (37%) Gaps:66/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VQLMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCEL--------------------SV 122
            |:|...:||:.:.:...:||| .::.:...:||  ::|.|..|                    |.
  Rat    71 VRLGEHNINVLEGNEQFVNAA-KIIKHPNFIRK--TLNNDIMLIKLSSPVKLNSRVATVALPSSC 132

  Fly   123 APSKRPCVRNSFKIVSGDGRDRTGENIKYG--QRFQLQCMAS----EHDPIVLYSGPKRCNLQQG 181
            ||:...|      ::||     .|..:.:|  :...|||:.:    :.|....|.|....|:   
  Rat   133 APAGTQC------LISG-----WGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM--- 183

  Fly   182 VHATYLSHK--------------NGELNLNLGLVHRSKLSC--PDNDIPIAYTNWFCRHVN 226
            |.|.:|...              ||||.   |:|... ..|  |||  |..||. .|.:|:
  Rat   184 VCAGFLEGGKDSCQGDSGGPVVCNGELQ---GIVSWG-YGCALPDN--PGVYTK-VCNYVD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 45/191 (24%)
Tryp_SPc 24..242 CDD:238113 45/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.