DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG10587

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:252 Identity:53/252 - (21%)
Similarity:95/252 - (37%) Gaps:83/252 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTIIFGAIVQ 79
            |...|:|.:|:        .:....|..|||   :::.       .||::.:|            
  Fly    89 FLGRVKISDWL--------AVGGASKLNDRG---IQRQ-------VKEVIKSA------------ 123

  Fly    80 LMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINE--DCELSVAPSKRPCVRNSFKIVSGDGR 142
                     :....|:|..::::..:|.: |.:|:.:  .|:..:.|...  :|     |||.| 
  Fly   124 ---------EFREDDMNMDVAILRLKKPM-KGKSLGQLILCKKQLMPGTE--LR-----VSGWG- 170

  Fly   143 DRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYL-----SHKNGELNLNLGL-- 200
              ..||.::|.:..|:.:..   |:|   ..|:|      .|:||     |||:.:|.|.:.|  
  Fly   171 --LTENSEFGPQKLLRTVTV---PVV---DKKKC------RASYLPTDWESHKHFDLFLKVHLTD 221

  Fly   201 ------VHRSKLSCP-DNDIPIAYTNWFCRHVN-----PKQRFESEGEDIPSNSPLV 245
                  |...|.:|. |:..|:.|.|..|..|:     ..:|:.....||....|.:
  Fly   222 SMFCAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 53/250 (21%)
Tryp_SPc 46..280 CDD:238113 53/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.