Sequence 1: | NP_001097339.1 | Gene: | CG34457 / 5740661 | FlyBaseID: | FBgn0085486 | Length: | 308 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649272.1 | Gene: | CG11037 / 40317 | FlyBaseID: | FBgn0037038 | Length: | 292 | Species: | Drosophila melanogaster |
Alignment Length: | 246 | Identity: | 45/246 - (18%) |
---|---|---|---|
Similarity: | 71/246 - (28%) | Gaps: | 97/246 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 EIVLAAPKQTIIFGAIVQ------------------------------LMPIHINISDMDTTDLN 96
Fly 97 AALSVV-INEKVVRK-------SQSINED-------------------------CELSVAPSKRP 128
Fly 129 CVRNSFKIVSGDG----RDRTGENI----------KYGQRFQLQCMASEHDPIVLYS--GPK-RC 176
Fly 177 NLQQGVHATYLSHKNGELNLNLGLVHRSKLSCPDNDIPIAYTNWFCRHVNP 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34457 | NP_001097339.1 | None | |||
CG11037 | NP_649272.1 | Tryp_SPc | 61..281 | CDD:214473 | 40/236 (17%) |
Tryp_SPc | 62..283 | CDD:238113 | 40/235 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BBP0 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |