DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG11037

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:246 Identity:45/246 - (18%)
Similarity:71/246 - (28%) Gaps:97/246 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EIVLAAPKQTIIFGAIVQ------------------------------LMPIHINISDMDTTDLN 96
            :|||.:|.:|.:.|..|.                              |...|..:..|..::..
  Fly    51 KIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWI 115

  Fly    97 AALSVV-INEKVVRK-------SQSINED-------------------------CELSVAPSKRP 128
            .|..:. :|:|.:|:       |:...||                         |.:|:.|... 
  Fly   116 VAAGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAKNIGTLSLCSVSLKPGVE- 179

  Fly   129 CVRNSFKIVSGDG----RDRTGENI----------KYGQRFQLQCMASEHDPIVLYS--GPK-RC 176
                  .:|||.|    |.|...|:          |...|...|..|...|.::..:  |.| .|
  Fly   180 ------LVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDAC 238

  Fly   177 NLQQGVHATYLSHKNGELNLNLGLVHRSKLSCPDNDIPIAYTNWFCRHVNP 227
            ....|....:.....|.::..:|        |..|..|..||:  ..:|.|
  Fly   239 TFDSGGPLVFKKQVCGIVSFGIG--------CASNRYPGVYTD--VMYVKP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 40/236 (17%)
Tryp_SPc 62..283 CDD:238113 40/235 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.