DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and Sems

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:152 Identity:28/152 - (18%)
Similarity:52/152 - (34%) Gaps:50/152 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GNWVEENCLEEDKIVNFKK---------------------QRDRGELLVEKARTLYDNF------ 59
            |..:..:.|:.::.::.||                     ....|..||  |...::||      
  Fly    12 GILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLV--AMRYFNNFICGGTL 74

  Fly    60 -HKEIVLAA---------PKQTIIFGAIVQLMPIHINIS----------DMDTTDLNAALSVVIN 104
             |:.|||.|         .:...:.|.|.:|....|...          .|.|.:::.|: |::|
  Fly    75 IHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAV-VLLN 138

  Fly   105 EKVVRKSQSINEDCELSVAPSK 126
            ..:|.|:......|..::.|.:
  Fly   139 RPMVGKNIGTLSLCSTALTPGQ 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 24/121 (20%)
Tryp_SPc 44..265 CDD:238113 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.