DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG32374

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:98 Identity:22/98 - (22%)
Similarity:35/98 - (35%) Gaps:30/98 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IVSGDGRDRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLS---HKNGELN-- 195
            :|.|..::.:|..:..|..:            :||.|| |...|     |:|.   ..|..:|  
  Fly    18 VVGGQSKNWSGYYVDNGTHY------------LLYEGP-RIKPQ-----TFLPGNISTNPAINAL 64

  Fly   196 -----LNLGLVHRSKLSCPDNDIPIA--YTNWF 221
                 |...:|:..|:.|.......|  |.|:|
  Fly    65 EAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYF 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 7/25 (28%)

Return to query results.
Submit another query.