DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG32374

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:98 Identity:22/98 - (22%)
Similarity:35/98 - (35%) Gaps:30/98 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IVSGDGRDRTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLS---HKNGELN-- 195
            :|.|..::.:|..:..|..:            :||.|| |...|     |:|.   ..|..:|  
  Fly    18 VVGGQSKNWSGYYVDNGTHY------------LLYEGP-RIKPQ-----TFLPGNISTNPAINAL 64

  Fly   196 -----LNLGLVHRSKLSCPDNDIPIA--YTNWF 221
                 |...:|:..|:.|.......|  |.|:|
  Fly    65 EAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYF 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 7/25 (28%)
Tryp_SPc 74..295 CDD:238113 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.