DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG32270

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:285 Identity:57/285 - (20%)
Similarity:87/285 - (30%) Gaps:124/285 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 WVEENCLEE--------------------DKIVNFKKQRD---RGELLVEK-----ARTLYDNFH 60
            |:.|:..||                    ..:||.:::.:   .|.|:..:     |..|.|   
  Fly    14 WIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLND--- 75

  Fly    61 KEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALSVVINEKVVRK--------------- 110
                 ..|...::.|.:..|       |||.            |.:.|||               
  Fly    76 -----GNPSDFVVRGGVTYL-------SDMR------------NSRYVRKILMPSAYSRTTLDHD 116

  Fly   111 ----------SQSINEDCELSVAPSKRPCVRNSFKIVSGDG-RDRTGENIKYGQRFQLQCMASEH 164
                      ..||.:...|:|. |.||   .||..|||.| .|.:..::..    |||   |.|
  Fly   117 VALLQLKQPLQASIAKPISLAVR-SPRP---GSFVRVSGWGLTDSSSTSLPN----QLQ---SVH 170

  Fly   165 DPIV-------LYSGPKR------CNLQQGVHATYLSHKNGE-LNLN---LGLV-----HRSKLS 207
            ..::       ||.|.:.      |....|:.........|. :|.|   :|:|     ||    
  Fly   171 VQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHR---- 231

  Fly   208 CPDNDIPIAY------TNWFCRHVN 226
            |...|.|..|      ::|...:::
  Fly   232 CAARDSPGVYSDVSYLSDWIADNIH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 52/262 (20%)
Tryp_SPc 31..254 CDD:238113 53/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.