DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG11192

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:82 Identity:18/82 - (21%)
Similarity:23/82 - (28%) Gaps:39/82 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GRDRTGENIKYGQRFQLQCMASEHDPIVLYS---GPKRCNLQQGVHATYLSHKNGELNLNLGLVH 202
            |||              .|......|:|.|:   ||.|.                     .|:|.
  Fly   206 GRD--------------SCQGDSGGPLVGYAAEEGPARL---------------------YGIVS 235

  Fly   203 RSKLSCPDNDIPIAYTN 219
            .. |.|.:.:.|..|||
  Fly   236 WG-LGCANPNFPGVYTN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 18/82 (22%)

Return to query results.
Submit another query.