DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG17571

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:39/115 - (33%) Gaps:41/115 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SC---PDNDIPIAYTNWFCRHVNPKQRFESEGEDIP-SNSPLVIVHATTNRN-------LAAENV 260
            ||   |..|.|      |.|.||        |||:. .|.|..:...||..:       :.:|.|
  Fly    17 SCHGNPGLDFP------FGRIVN--------GEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETV 67

  Fly   261 L-----IQTLFGPEFLV-----------SVQNYRNIYRHEIWKNVWMISN 294
            |     :|:....|..|           .|...|....||.:.:..||::
  Fly    68 LTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMIND 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 22/96 (23%)
Tryp_SPc 31..254 CDD:238113 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.