DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG17571

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_610109.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:39/115 - (33%) Gaps:41/115 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SC---PDNDIPIAYTNWFCRHVNPKQRFESEGEDIP-SNSPLVIVHATTNRN-------LAAENV 260
            ||   |..|.|      |.|.||        |||:. .|.|..:...||..:       :.:|.|
  Fly    17 SCHGNPGLDFP------FGRIVN--------GEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETV 67

  Fly   261 L-----IQTLFGPEFLV-----------SVQNYRNIYRHEIWKNVWMISN 294
            |     :|:....|..|           .|...|....||.:.:..||::
  Fly    68 LTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMIND 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG17571NP_610109.1 Tryp_SPc 30..251 CDD:214473 22/96 (23%)

Return to query results.
Submit another query.