DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and Ser12

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:143 Identity:30/143 - (20%)
Similarity:54/143 - (37%) Gaps:32/143 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVRIGNWVEENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEIVLAAPKQTIIFGAIVQLMP 82
            |||:|:..:....:..::...:|..|      ..:.|:..|   :|.:.....|:||.|  ::.|
  Fly    75 SVRVGSVWKNLGGQHARVAVIRKHED------YVSSTILFN---DIAVIRLVDTLIFNA--EVRP 128

  Fly    83 I-------------------HINISDMDTTDLNAALSVVINEKVVRKS-QSINEDCELSVAPSKR 127
            |                   .|.|..:..|.|......:::..|.::| |.|.:....:.|..|.
  Fly   129 IQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMICAAALLKD 193

  Fly   128 PCVRNS-FKIVSG 139
            .|..:| ..:|||
  Fly   194 SCHGDSGGPLVSG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 30/143 (21%)
Tryp_SPc 24..238 CDD:238113 30/143 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.