DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and Ser6

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:261 Identity:59/261 - (22%)
Similarity:90/261 - (34%) Gaps:78/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VGDMDSISARFQPSVRIGNWVEENC-----------------LEEDKIVNF-------------- 38
            ||..|::..:|...|.:.|....:|                 ..||  ||.              
  Fly    33 VGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNED--VNHVITPIAAERFTIRA 95

  Fly    39 -KKQRDRGELLVEKARTL----YDNFHKEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAA 98
             ...|..|.:||:.|..:    |.||..::.|...:..:|..|.:|  ||     |:.|.|..|.
  Fly    96 GSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQ--PI-----DLPTVDTPAD 153

  Fly    99 LSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIKYGQRFQLQCMASE 163
            :.|||:.....|.|          ....|....|:.|.::   |.:..|.|.:|...:| |:..:
  Fly   154 VDVVISGWGRIKHQ----------GDLPRYLQYNTLKSIT---RQQCEELIDFGFEGEL-CLLHQ 204

  Fly   164 HDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGLVHRSKLSC----PDNDIPIAY-TNWFCR 223
            .|     :|  .||...|..|.|    |.:|   :|:.......|    ||....:.| .:|..:
  Fly   205 VD-----NG--ACNGDSGGPAVY----NNQL---VGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255

  Fly   224 H 224
            |
  Fly   256 H 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 57/256 (22%)
Tryp_SPc 32..256 CDD:238113 58/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.