DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and LOC3291694

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_555167.2 Gene:LOC3291694 / 3291694 VectorBaseID:AGAMI1_013239 Length:277 Species:Anopheles gambiae


Alignment Length:79 Identity:19/79 - (24%)
Similarity:30/79 - (37%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 CRHVNPKQRFESEGEDIPSNSPLVIVHATTNRNLAAENVLIQTLFGPEFLVSVQNYRNIYR--HE 284
            |....|..|.......:|...|.  :|..:|.:.......|.....| :.||:| |.|.:|  ..
Mosquito    19 CAQAQPSGRHHLVHPLLPRFLPR--LHRGSNGHRVVGGFQIDVSDAP-YQVSLQ-YFNSHRCGGS 79

  Fly   285 IWKNVWMISNGHQT 298
            :..|.|:::..|.|
Mosquito    80 VLDNKWVLTAAHCT 93

Return to query results.
Submit another query.