DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and LOC3290448

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_321900.4 Gene:LOC3290448 / 3290448 VectorBaseID:AGAMI1_012340 Length:271 Species:Anopheles gambiae


Alignment Length:67 Identity:17/67 - (25%)
Similarity:28/67 - (41%) Gaps:11/67 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NLGLVH-RSKLSCPDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSPLVI-VHATTNRNLAAEN 259
            |:|::. .|..:.|..::.|. |.|...        ||.|..:|:...|.: |.:|.|....|.|
Mosquito   135 NIGIIQPTSSGTIPSGELAIV-TGWGAT--------ESNGNFVPNLRSLAVKVWSTKNCTDQAAN 190

  Fly   260 VL 261
            .:
Mosquito   191 YM 192

Return to query results.
Submit another query.