DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG33160

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:36 Identity:9/36 - (25%)
Similarity:17/36 - (47%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 EFLVSVQNYRNIYRHEIWKNVWMISNGHQTGSKSAN 304
            ::||.|.....:....:.|..|:|:..|...:|:.|
  Fly    46 KYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 9/36 (25%)

Return to query results.
Submit another query.