DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and CG31681

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:275 Identity:49/275 - (17%)
Similarity:97/275 - (35%) Gaps:87/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LAAPKQTIIFGAI--VQLMPIHINISD-----------MDTTDLNAA---LSVVINEKVVR---- 109
            :..|::.|:.|:.  ::.:|..:::.:           .|...|.||   .:|.:.:..||    
  Fly    22 IPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSS 86

  Fly   110 ---KSQSINEDCELSVAPSKRPCVRNSFKI--VSGDGRDRTGENIKYGQRFQLQCMASEHDP--- 166
               |...:.:..:....|...|.:.|.:.|  :..:...|.|..:|       :...:|..|   
  Fly    87 YWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVK-------KIPLAEQTPVAG 144

  Fly   167 -IVLYS--GPKRCN------LQQGVHATYLSHKN-----GELNLNLGLVHRSKLSCPDNDIPIAY 217
             |||.|  |..|.|      :.||||...|:..:     ..:|:.:.::      |.|.      
  Fly   145 TIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMI------CADG------ 197

  Fly   218 TNWFCRHVNPKQRFES-EGEDIPSNSPLVIVHATTNRNLAAENVLIQTLFG------PEFLVSVQ 275
                       ||::: :|:   |..||:......:|.|..     ...:|      |.....:.
  Fly   198 -----------QRWDTCQGD---SGGPLIETTKGGHRQLIG-----MVSWGDGCGTNPGVYEDIA 243

  Fly   276 NYRNIYRHEIWKNVW 290
            .:.|..::.:.||::
  Fly   244 FFHNWIKYTVKKNIY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 46/258 (18%)
Tryp_SPc 29..250 CDD:238113 46/258 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.