DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and LOC286960

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:219 Identity:52/219 - (23%)
Similarity:79/219 - (36%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPCRVGDMDSISARFQPSVRIGNWV--EENCLEEDKIVNFKKQRDRGELLVEKARTLYDNFHKEI 63
            :|.:|...|.||.:...|:....||  ..:|.:.      |.|...||          .|.|   
  Rat    35 VPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKR------KLQVRLGE----------HNIH--- 80

  Fly    64 VLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCELSVAPSKRP 128
            ||...:|.|....|::    |... :.||.| |..:.:.:....|..||........|.|.:...
  Rat    81 VLEGGEQFIDAEKIIR----HPEY-NKDTLD-NDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQ 139

  Fly   129 CVRNSFKIVSGDGRDRTGENIKYGQRFQ--LQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKN 191
            |      :|||     .|..:..|.::.  |||:.:   |::..|..|:         :|    .
  Rat   140 C------LVSG-----WGNTVSIGGKYPALLQCLEA---PVLSASSCKK---------SY----P 177

  Fly   192 GELNLN---LGLVHRSKLSCPDND 212
            |::..|   ||.:...|.|| |.|
  Rat   178 GQITSNMFCLGFLEGGKDSC-DGD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 52/219 (24%)
Tryp_SPc 24..243 CDD:238113 52/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.