DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and Prss3b

DIOPT Version :9

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:197 Identity:40/197 - (20%)
Similarity:62/197 - (31%) Gaps:65/197 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HKEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCELSVAP 124
            |...|:...:|.|....|::....:.|..|.|...:.......:|.:|             |...
  Rat    77 HNIDVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRV-------------STVS 128

  Fly   125 SKRPCVRNSFK-IVSGDGRDRTGENIKYGQRFQ--LQCMASEHDPIVLYSGPKRCNLQQGVHATY 186
            ..|.|..:..| :|||     .|..:..|..:.  |||:.:   |::..|..|            
  Rat   129 LPRSCGSSGTKCLVSG-----WGNTLSSGTNYPSLLQCLDA---PVLSDSSCK------------ 173

  Fly   187 LSHKNGELNLN---LGLVHRSKLSCP-DNDIPI-----------------------AYTNWFCRH 224
             |...|::..|   ||.:...|.||. |:..|:                       .||. .|.:
  Rat   174 -SSYPGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTK-VCNY 236

  Fly   225 VN 226
            ||
  Rat   237 VN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34457NP_001097339.1 None
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 40/197 (20%)
Tryp_SPc 25..243 CDD:238113 40/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.