Sequence 1: | NP_001097339.1 | Gene: | CG34457 / 5740661 | FlyBaseID: | FBgn0085486 | Length: | 308 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036861.1 | Gene: | Prss2 / 25052 | RGDID: | 3418 | Length: | 246 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 42/199 - (21%) |
---|---|---|---|
Similarity: | 67/199 - (33%) | Gaps: | 82/199 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 VQLMPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCEL--------------------SV 122
Fly 123 APSKRPCVRNSFKIVSGDGRD-RTGENIKYGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATY 186
Fly 187 LSHKNGELNLNL---GLVHRSKLSC--------------------------PDNDIPIAYTNWFC 222
Fly 223 RHVN 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34457 | NP_001097339.1 | None | |||
Prss2 | NP_036861.1 | Tryp_SPc | 23..239 | CDD:214473 | 42/199 (21%) |
Tryp_SPc | 24..242 | CDD:238113 | 42/199 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BBP0 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |