DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34457 and LOC1277689

DIOPT Version :10

Sequence 1:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_317172.3 Gene:LOC1277689 / 1277689 VectorBaseID:AGAMI1_014277 Length:267 Species:Anopheles gambiae


Alignment Length:73 Identity:18/73 - (24%)
Similarity:27/73 - (36%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 IPSNSPLVIVHATTN-------RNLAAENVLIQTLFGPEFLVSVQNYRNIYRHEIWKNVWMISNG 295
            :|.....|.....||       .|.|..|.:::....|  .|..:..|..|.|:...: .|:..|
Mosquito   148 LPEQDEAVYAGTMTNVSGWGSTHNAAESNAILRAANVP--TVGQEKCREAYSHDAITD-RMLCAG 209

  Fly   296 HQTGSKSA 303
            :|.|.|.|
Mosquito   210 YQQGGKDA 217

Return to query results.
Submit another query.