DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34278 and CG44040

DIOPT Version :10

Sequence 1:NP_001097817.1 Gene:CG34278 / 5740656 FlyBaseID:FBgn0085307 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001262594.1 Gene:CG44040 / 14462475 FlyBaseID:FBgn0264832 Length:60 Species:Drosophila melanogaster


Alignment Length:91 Identity:39/91 - (42%)
Similarity:46/91 - (50%) Gaps:31/91 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFAVLFLFCGIVGFAMVASTSPSADYDYGSDSTTEQDTTAPASDTTLAPLAQPPCGSGPQGPC 65
            |||||:|||.|.|||||.            .|.|||..:.::..|.|:.|| :..|||:||||| 
  Fly     1 MKFFAILFLLCAIVGFAA------------SSTSTTTTEASSDTSTTSAAP-SPVPCGNGPQGP- 51

  Fly    66 GQVPPPLPPCVGGPGGLCGKKLYFFY 91
                             |||||||||
  Fly    52 -----------------CGKKLYFFY 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34278NP_001097817.1 MSA-2c <34..81 CDD:289042 15/46 (33%)
CG44040NP_001262594.1 None

Return to query results.
Submit another query.