DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34289 and T01G5.7

DIOPT Version :10

Sequence 1:NP_001247265.1 Gene:CG34289 / 5740640 FlyBaseID:FBgn0085318 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_506726.2 Gene:T01G5.7 / 187960 WormBaseID:WBGene00011342 Length:260 Species:Caenorhabditis elegans


Alignment Length:38 Identity:14/38 - (36%)
Similarity:19/38 - (50%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DNEQRYPHHISCGHSFCSACLKKYL-ELGRDSRCPLCR 58
            |||.|.|..:.|||:.|..|:...: |...:..||..|
 Worm   198 DNEDRLPRVMDCGHTMCHTCIISTINESDTEPICPFDR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34289NP_001247265.1 RAD18 26..>79 CDD:227719 11/34 (32%)
T01G5.7NP_506726.2 EnvC 1..>189 CDD:443969
RING-HC_RNF222 188..239 CDD:438226 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.