DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nvd and AT4G29890

DIOPT Version :9

Sequence 1:NP_001097670.1 Gene:nvd / 5740633 FlyBaseID:FBgn0287185 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_194718.2 Gene:AT4G29890 / 829111 AraportID:AT4G29890 Length:422 Species:Arabidopsis thaliana


Alignment Length:365 Identity:70/365 - (19%)
Similarity:111/365 - (30%) Gaps:132/365 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ELPPPYPNGWYGILKSSQLKAGEATCVSCLGE-DLVIFRSKKDIVFILDAYCPHLGANLGIGGSV 151
            ||...:..||..:..|.|:|.........||: |.|:.|.:...:......|.| .|::...|:.
plant    87 ELDRVFYGGWQAVGYSDQIKESRDFFTGRLGDVDFVVCRDENGKIHAFHNVCSH-HASILASGNG 150

  Fly   152 ADDCVICPFHQWKFRGTDGLCINIPYSTSVPKGSKLKKWISQEVDGF-----------IFIW--- 202
            ...|.:|.:|.|            .||.|   ||.:|......:..|           :.:|   
plant   151 RKSCFVCLYHGW------------TYSLS---GSLVKATRMSGIQNFSLSEMGLKPLRVAVWGPF 200

  Fly   203 ------------YHAEQTEL---PWDLPVPMGE-----IDDTFVYHGHNEFYINCH--------- 238
                        ...|..||   .| |...:|.     :|....|....|:.|:|:         
plant   201 VLLKVTAATSRKGEVETDELVASEW-LGTSVGRLSQGGVDSPLSYICRREYTIDCNWKVFCDNYL 264

  Fly   239 -------------------------------IQE------IPENGADIAHFNAIHK---KNF-IN 262
                                           |||      :.|:|.|.....|::.   .|| ||
plant   265 DGGYHVPYAHKGLMSGLDLETYSTTIFEKVSIQECGGGSKVGEDGFDRLGSEALYAFVYPNFMIN 329

  Fly   263 --GSWAQKKRLFGLGSHHWKARWSPFTGKLKYLAEVNLSHTFKLFGKFGCFRMEVSGK-QIGPSI 324
              |.|.....:..||..           |.|.:.:..|..:.|....|....:|.|.: |:...:
plant   330 RYGPWMDTNLVLPLGPR-----------KCKVVFDYFLDPSLKDDEAFIKRSLEESDRVQMEDVM 383

  Fly   325 VC------LEVNSYTFGKIKVFQYITPIEPMLQKVVHEFY 358
            :|      ||..:|..|:.          .:::|.:|.|:
plant   384 LCESVQRGLESQAYDKGRY----------ALVEKPMHHFH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nvdNP_001097670.1 Rieske_RO_Alpha_N 97..210 CDD:239551 26/139 (19%)
AT4G29890NP_194718.2 HcaE 69..406 CDD:226985 67/356 (19%)
Rieske_RO_Alpha_CMO 95..212 CDD:239614 26/132 (20%)
RHO_alpha_C_CMO-like 245..421 CDD:176892 34/190 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1199207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.