DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc20 and JAC1

DIOPT Version :9

Sequence 1:NP_001097616.1 Gene:Hsc20 / 5740624 FlyBaseID:FBgn0263606 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_011497.1 Gene:JAC1 / 852866 SGDID:S000002986 Length:184 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:40/167 - (23%)
Similarity:86/167 - (51%) Gaps:19/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YFKLL--SFPIQ---FSLESQKLTRSFRQLQTIVHPDKYSNKTSREQTNSSDWSSLINKAYKTLS 135
            :::|.  :||.:   ::::..:|.:.:||||...|||.        ....|:.||.:|:||.||.
Yeast    14 FYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDM--------AQQGSEQSSTLNQAYHTLK 70

  Fly   136 TPIDRGQYLLQ------LEGEQMPQDNSALNKEFLMAMMERNEEVEDAEDTQTLENLNIQLIKEL 194
            .|:.|.||:|:      |..||...:.:..:.:.|:.:::.::|:...:|...::.|..|..:.:
Yeast    71 DPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERI 135

  Fly   195 EEMARKLNALFDSKDLSGVKETLVEMKYLLSIQNSIK 231
            :::..:|...::.||.:...:..||:||..::..:.|
Yeast   136 QDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc20NP_001097616.1 hscB 75..239 CDD:235133 40/167 (24%)
DnaJ 75..135 CDD:99751 18/63 (29%)
HSCB_C 159..231 CDD:285042 12/71 (17%)
JAC1NP_011497.1 hscB 29..179 CDD:211601 37/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344147
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1740
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004407
OrthoInspector 1 1.000 - - oto99097
orthoMCL 1 0.900 - - OOG6_102596
Panther 1 1.100 - - LDO PTHR14021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3856
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.