DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc20 and SPAC144.08

DIOPT Version :9

Sequence 1:NP_001097616.1 Gene:Hsc20 / 5740624 FlyBaseID:FBgn0263606 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001342917.1 Gene:SPAC144.08 / 2542900 PomBaseID:SPAC144.08 Length:225 Species:Schizosaccharomyces pombe


Alignment Length:200 Identity:49/200 - (24%)
Similarity:87/200 - (43%) Gaps:46/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AQFNQFQLPEIRKFSVESSPACWNCQKKSELKQNMICSDCGHLQDVNSGINYFKLLSFPIQ---- 85
            |:|..:.|.:|..::...|.:|     :||.|                  |::|.....|.    
pombe    34 ARFKFYPLNKIVNYNHFHSSSC-----QSEAK------------------NFYKQFEGDISDPPP 75

  Fly    86 ---FSLESQKLTRSFRQLQTIVHPDKYSNK-TSREQTNSSDWSSLINKAYKTLSTPIDRGQYLLQ 146
               |.::...|..|:.:....:|||....| .:..|.:|::    ::|||.||..|:.|.:|:||
pombe    76 KGPFDIDLGALKSSYLRKMKTLHPDVAQGKDAALAQRDSAE----LSKAYNTLKAPLTRAEYILQ 136

  Fly   147 LEG-EQMPQDNSALNKEFLMAMMERNEEVEDAED--------TQTLENLNIQLIKELEEMARKLN 202
            |:| ..:.:|.|..:.||||.:|:.:|.:..:.|        :|..:...:|.|.|:.:.....|
pombe   137 LQGINPVSEDISNSDPEFLMEIMDVHENISASRDSPEKLLQLSQENQGRKVQEINEIRKAMESSN 201

  Fly   203 ALFDS 207
              :||
pombe   202 --WDS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc20NP_001097616.1 hscB 75..239 CDD:235133 39/149 (26%)
DnaJ 75..135 CDD:99751 16/67 (24%)
HSCB_C 159..231 CDD:285042 13/56 (23%)
SPAC144.08NP_001342917.1 DjlA 68..225 CDD:224002 37/142 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004407
OrthoInspector 1 1.000 - - oto100609
orthoMCL 1 0.900 - - OOG6_102596
Panther 1 1.100 - - LDO PTHR14021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3856
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.