DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C1galt1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_443719.3 Gene:C1galt1 / 94192 MGIID:2151071 Length:363 Species:Mus musculus


Alignment Length:283 Identity:86/283 - (30%)
Similarity:138/283 - (48%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRKPAKRSNQHTLDPLYEEIRILCMI---PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELE 92
            |....|..|....:.||::::|||.:   |.|...  .||:||.||.:.||.:||:|.:.:.:. 
Mouse    68 DSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEK--KAKHVKATWAQRCNKVLFMSSEENQDF- 129

  Fly    93 PYVPVINSTDTWTLVQQGLMQAYL-----------FYADQIDWFLRVEPSSFVVLENLRYMIHKR 146
               |.:.     ...::|..|.|.           .|.:..|||::.:..::|:::|||:::  .
Mouse   130 ---PTVG-----LKTKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLL--S 184

  Fly   147 KYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIH 211
            ||.|.||||||...:..| .:.::...:|||:|:|||||:..|.|   .::||| ...:|.|.:.
Mouse   185 KYNPEQPIYFGRRFKPYV-KQGYMSGGAGYVLSKEALRRFVNAFK---TEKCTH-SSSIEDLALG 244

  Fly   212 RCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIP---WLRKLSYHKRTEKTVPISSRAIC 273
            ||:...||...:|||....|||.|...::..:.||  :|   |....:|:...|.....|..|:.
Mouse   245 RCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGY--LPKTFWYWNYNYYPPIEGPGCCSDIAVS 307

  Fly   274 FLVEYPPEMYDYYYFVYRLKIFG 296
            |.......||:..|.||.|:.:|
Mouse   308 FHYVDGTTMYELEYLVYHLRPYG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
C1galt1NP_443719.3 Galactosyl_T 107..>248 CDD:304462 49/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.