DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and AT5G12460

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_568279.2 Gene:AT5G12460 / 831121 AraportID:AT5G12460 Length:441 Species:Arabidopsis thaliana


Alignment Length:122 Identity:26/122 - (21%)
Similarity:46/122 - (37%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENL-----RYMIHKRKYQPSQPIYF 156
            :.|...|...:...|.:::...:.:..||:..:..:...|:||     ||. ||:.|      |.
plant   100 ITNKFKTQIRLFYSLQESFKKASKETRWFVIGDDDTLFFLDNLVKALDRYN-HKKHY------YV 157

  Fly   157 GYELENIVTHESFV----HHHSGYVIS-----------REALRRYTMASKDPENKEC 198
            |...||:.::..|.    :...||.:|           .|.::||.....|..:..|
plant   158 GMNSENVWSNAIFAFDMGYGGGGYALSYPTVVTLLSNMEECIKRYLGVYSDLLSFRC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
AT5G12460NP_568279.2 Galactosyl_T <126..>184 CDD:304462 17/64 (27%)
Galactosyl_T 167..416 CDD:304462 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.