DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C1galt1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_038964253.1 Gene:C1galt1 / 65044 RGDID:621105 Length:371 Species:Rattus norvegicus


Alignment Length:283 Identity:85/283 - (30%)
Similarity:137/283 - (48%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRKPAKRSNQHTLDPLYEEIRILCMI---PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELE 92
            |....|..|....:.||:::::||.:   |.|...  .||:||.||.:.||.:||:|.:.:.:. 
  Rat    76 DSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEK--KAKHVKATWAQRCNKVLFMSSEENKDF- 137

  Fly    93 PYVPVINSTDTWTLVQQGLMQAYL-----------FYADQIDWFLRVEPSSFVVLENLRYMIHKR 146
               |.:...     .::|..|.|.           .|.:..|||::.:..::|:|:|||:::  .
  Rat   138 ---PTVGLE-----TKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLRWLL--S 192

  Fly   147 KYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIH 211
            ||.|.||||||...:..| .:.::...:|||:|:|||||:..|.|   .::||| ...:|.|.:.
  Rat   193 KYNPEQPIYFGRRFKPYV-KQGYMSGGAGYVLSKEALRRFVDAFK---TEKCTH-SSSIEDLALG 252

  Fly   212 RCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIP---WLRKLSYHKRTEKTVPISSRAIC 273
            ||:....|...:|||....|||.|...::..:.||  :|   |....:|:...|.....|..|:.
  Rat   253 RCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGY--LPKTFWYWNYNYYPPVEGPGCCSDIAVS 315

  Fly   274 FLVEYPPEMYDYYYFVYRLKIFG 296
            |.......||:..|.||.|:.:|
  Rat   316 FHYVDSTTMYELEYLVYHLRPYG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
C1galt1XP_038964253.1 Galactosyl_T 115..>256 CDD:419759 50/156 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.