DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_067525.1 Gene:C1galt1c1 / 59048 MGIID:1913493 Length:316 Species:Mus musculus


Alignment Length:309 Identity:78/309 - (25%)
Similarity:124/309 - (40%) Gaps:80/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYNYNSPDTAKYVKRTWGKHC---------NVLLF 82
            :||.:|....:|           .|:.|::............||.||.|||         ||.:|
Mouse    53 ISEAERMELSKS-----------FRVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVF 106

  Fly    83 VSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRK 147
            .|.::|           :.|.|.::::....||..|.||.:||....|::|.|:|||:|.:.|: 
Mouse   107 ESINMD-----------TNDMWLMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKK- 159

  Fly   148 YQPSQPIYFGY-----ELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYV-- 205
             ..|||.|.|:     :||       :|....|.|:|.|:::|.......||  :|....|.:  
Mouse   160 -DQSQPFYLGHTVKSGDLE-------YVSVDGGIVLSIESMKRLNSLLSVPE--KCPEQGGMIWK 214

  Fly   206 --EGLDIHRCLRFA-----NVTVAESRDEFEHET---FLPVTMDYQFLNGYDTIPWLRKLSYHKR 260
              |...:..||::|     |...|:.:|.|..::   |:...|..|                   
Mouse   215 ISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQ------------------- 260

  Fly   261 TEKTVP--ISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSIDFRP 307
            ..:.|.  .|..|:.|....|.:|:...|.||||:.||....:::.|.|
Mouse   261 PNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLP 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.