DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and CG34452

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 / 5740876 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster


Alignment Length:306 Identity:103/306 - (33%)
Similarity:155/306 - (50%) Gaps:18/306 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPRRVYYGLFLALILFLILTLYINVS-EVDRKPAKRSNQHTLDPLYEEIRILCMI-PYNYNSPDT 65
            |.||::.|...|:.|.::.|::..|. .:.|....|....:..|  ...||.|:| .|.|.....
  Fly     6 STRRLFLGGKNAIYLLILGTMFYAVMLHLPRNFKSREVVESYGP--PPARIFCIISTYAYRHGHA 68

  Fly    66 AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEP 130
            |.::.|||.:||:..||||.|||..|||.| .:|..|.|..::..|...|.::..|.||||....
  Fly    69 AIHIHRTWVRHCDHYLFVSDDIDNHLEPAV-FMNMPDKWHRMRAYLEYVYKYHFHQGDWFLYCND 132

  Fly   131 SSFVVLENLRYMIHKRKYQPSQPIYFGYEL---ENIVTHESFVHHHSGYVISREALRRYTMASKD 192
            .:|||::|||:|:  :.|.|.:.||||.:|   ..:|    |:...||.|.|..||:|:.:.:..
  Fly   133 DNFVVVDNLRHML--KTYSPKELIYFGCKLRTTNGLV----FMLEGSGIVFSAAALKRFALTALT 191

  Fly   193 PENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQF---LN-GYDTIPWLR 253
            .|:...:..:|.....::.|||...||...:|||||:...|||...|...   :| ..:...:..
  Fly   192 NESICSSETKGNDFTKELGRCLTNVNVIAGDSRDEFQRHRFLPFDADLHLGSSMNESLENHKYFL 256

  Fly   254 KLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 299
            ..||:...:..:|:|..:|||.|.|...:||.|||.|:.:|||.|:
  Fly   257 DHSYYPVNDMNLPVSLHSICFHVPYTLNIYDLYYFAYKTRIFGVPL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.