DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and LOC564281

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_692721.4 Gene:LOC564281 / 564281 -ID:- Length:341 Species:Danio rerio


Alignment Length:329 Identity:89/329 - (27%)
Similarity:143/329 - (43%) Gaps:55/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VYYGLFLALILFLILTLYINVSEVDRKPAKRSNQHT-----------LDPLYEEIRILCMI---P 57
            ::.|:.|..: |:...:|:.:......||...:.|.           :..||..:|:||.|   |
Zfish    24 LFCGILLGFV-FVQQLVYLRIEGRTLTPAHILSSHAKSHAWNKKADLVQSLYPRVRVLCWIMTRP 87

  Fly    58 YNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTL---VQQGLMQAY---- 115
            .|...  ..::|..||.:|||::|::|.             .|:|..|:   |.:|..|.|    
Zfish    88 ENLQK--RLQHVNATWAQHCNLVLYMSS-------------QSSDFPTVGLNVSEGRSQLYWKTI 137

  Fly   116 -------LFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHH 173
                   ..:....||||:.:..:|||||||||::  .::...:|:|||::....| .:.::...
Zfish   138 RAFQHIQKHHLQHADWFLKADDDTFVVLENLRYLL--SQHDTEKPLYFGHKFRPFV-RQGYMSGG 199

  Fly   174 SGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTM 238
            :|||:|||||||:....   ....|||:.. :|.:.:.||:....|...::||....|||.|...
Zfish   200 AGYVLSREALRRFVQGF---VTGRCTHFSS-LEDMALGRCMEIMGVKAVDTRDANLRETFNPFWP 260

  Fly   239 DYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSI 303
            |...::..:|.......||:|........|...|.|......:||...|:.|.|:.||...|   
Zfish   261 DKHLIHKDNTKKQDSLYSYYKTKLGPECCSDFVISFHYLRAADMYMLEYYTYHLRPFGYKYR--- 322

  Fly   304 DFRP 307
             |.|
Zfish   323 -FNP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
LOC564281XP_692721.4 Galactosyl_T <153..>244 CDD:304462 34/97 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.