DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and c1galt1a

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001070842.1 Gene:c1galt1a / 557675 ZFINID:ZDB-GENE-061013-303 Length:408 Species:Danio rerio


Alignment Length:281 Identity:89/281 - (31%)
Similarity:132/281 - (46%) Gaps:39/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KRSNQ-----HTLDPLYEEIRILCMI---PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDID---- 88
            |..||     |..|.|::::||||.:   |.|..|  .|::||.||.:||||:||:|.:.|    
Zfish    73 KHPNQPGEDGHIADELFKKVRILCWVMTGPSNLQS--KAQHVKNTWSRHCNVVLFMSSEEDRSFP 135

  Fly    89 --------GELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHK 145
                    |..:.|         |..: :....|...:..:.||||:.:..:|||::|||:::  
Zfish   136 TVGLGTGEGRDQLY---------WKTI-RAFHYALKNHGHEADWFLKADDDTFVVVDNLRWIL-- 188

  Fly   146 RKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDI 210
            ..|.|.||||||...:. .|.:.::...:|||:|:|||||:.   :....|.|||... ||.|.:
Zfish   189 SNYTPEQPIYFGKRFKP-YTKQGYMSGGAGYVLSKEALRRFV---EGFSTKVCTHTTP-VEDLAM 248

  Fly   211 HRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFL 275
            .:||....|...:|||....|||.|...::.....:....|.....|:...|.....|..|:.|.
Zfish   249 GQCLEKMGVLAGDSRDSLHRETFHPFIPEHHLTGKFSKTFWYWNYCYYPIVEGPQCCSDLAVSFH 313

  Fly   276 VEYPPEMYDYYYFVYRLKIFG 296
            ...|..||...|:.|.|:.||
Zfish   314 YVDPVLMYTLEYYTYHLRPFG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
c1galt1aNP_001070842.1 Galactosyl_T <169..292 CDD:304462 45/129 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.