DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and CG34056

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster


Alignment Length:309 Identity:90/309 - (29%)
Similarity:162/309 - (52%) Gaps:31/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLALILFLILTLYI-------------NVSEVDRKPAKRSNQHTLDP-LYEEIRILCMI---PY 58
            |.|.||:.:.||.::             ::::::...::.:.:..|.. |:.|.|:|||:   |.
  Fly     8 LVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQLATEEELALWLHNETRVLCMVLTLPK 72

  Fly    59 NYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGEL---EPYVPVINSTDTWTLVQQGLMQAYLFYAD 120
            |:.|  ..:.||.|||:.||.|:|:|...|.||   :..||. :..:.:..:::.|...|..:.:
  Fly    73 NHQS--RVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPE-DRNNLYLKMRKALEYVYRNHGE 134

  Fly   121 QIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRR 185
            ..||||:.:..:||::||||::::  .|.|...:|||:....... :.::...:|||:||:||||
  Fly   135 DYDWFLKADDDTFVIMENLRFLLY--PYDPEAALYFGHRFRTTFP-QGYMSGGAGYVMSRDALRR 196

  Fly   186 YTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIP 250
            ..:.:.:  |.:........|...|..||:...|...:||||...:.|||:::.: .|..:.|..
  Fly   197 LNLFAFN--NSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKF-MLPTFPTDN 258

  Fly   251 WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 299
            ||.||::::...:|...|..:..::..:..|||:  |.:|||.|||||:
  Fly   259 WLPKLTFYEPVNETGSTSGISFHYVKIHEFEMYE--YLLYRLHIFGTPL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 49/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.