DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and c1galt1b

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_956345.1 Gene:c1galt1b / 337131 ZFINID:ZDB-GENE-030131-9075 Length:374 Species:Danio rerio


Alignment Length:267 Identity:77/267 - (28%)
Similarity:133/267 - (49%) Gaps:24/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DPLYEEIRILCMIPYNYNSPDT----AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI--NSTD 102
            |.||:.:||||.:   ...||.    |::||.||.:|||:::|:| .:|   .|..|.:  |:.:
Zfish    81 DSLYKRVRILCWV---MTGPDNLEKKARHVKATWSRHCNIVVFIS-SVD---NPDFPTVGLNTKE 138

  Fly   103 TWTLVQQGLMQAYLF----YADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENI 163
            ....:....::|:.:    ::|:.||||:.:..::|:::|||:::  .::.|..|:|||...:..
Zfish   139 GRDQLYWKTIRAFHYVMEKHSDEADWFLKADDDTYVIVDNLRWIL--ARHSPEDPVYFGRRFKPY 201

  Fly   164 VTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEF 228
            | .:.::...:|||:|:|||||:....:   .|.|||... ||.|.:.:|:....|...:|||..
Zfish   202 V-KQGYMSGGAGYVLSKEALRRFVEGFR---TKVCTHTTS-VEDLAMGQCMEKIGVKAGDSRDTM 261

  Fly   229 EHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLK 293
            :.|||.|...:......:....|.....|:...:.....|..|:.|.......||...|:.|.|:
Zfish   262 QRETFHPFVPESHLTGTFPKTFWYWNYCYYPIVQGPQCCSDLAVSFHYVDASHMYLLEYYTYHLR 326

  Fly   294 IFGTPVR 300
            .||...|
Zfish   327 AFGYKYR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
c1galt1bNP_956345.1 Galactosyl_T 107..274 CDD:304462 54/177 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.