DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and CG3119

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster


Alignment Length:310 Identity:85/310 - (27%)
Similarity:148/310 - (47%) Gaps:38/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLFLALILFLILTLYI-NVSEVDRKPAKRSNQHTLDPLYEE----IRILCMI---PYNYNSPDTA 66
            |.....:|..:|.||: :||.|....:..|...|......|    .|||||:   |.|..|  .|
  Fly    16 GFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGPPPRILCMVLTCPENVQS--LA 78

  Fly    67 KYVKRTWGKHCNVLLFVSGDIDGELEP--YVPVINST-----DTWTLVQQGLMQAYLFYADQIDW 124
            :.|..|||:.|:.|:|.|.:   :.||  .|.|:..|     |.|...::|....:..||...||
  Fly    79 RSVYETWGQRCSRLIFASSE---DYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDW 140

  Fly   125 FLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMA 189
            ||:.:..::||:|||::::  |.:.|:.|::|||::...  :.|::...:.|::|||||.|:...
  Fly   141 FLKADDDTYVVMENLQHLL--RGFDPNTPVFFGYKMSRY--NVSYMSGGASYILSREALHRFATQ 201

  Fly   190 SKD-----PENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHET---FLPVTMDYQFLNGY 246
            :.:     |:.|:..     :|...:..|::...|...:|....:.:|   |:|:.::....:..
  Fly   202 AYESEVICPQPKKMG-----IEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDAN 261

  Fly   247 DTIP-WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIF 295
            .||| |||.:|..:........|:.::.|.......|:.|.:.:|.||:|
  Fly   262 YTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.