DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_955961.2 Gene:c1galt1c1 / 324052 ZFINID:ZDB-GENE-030131-2772 Length:317 Species:Danio rerio


Alignment Length:333 Identity:77/333 - (23%)
Similarity:139/333 - (41%) Gaps:67/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VYYGLFLALILFLILT------------LYINVSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYN 59
            ::.|:| .||:....|            |:.::..|.:...::.::..:.....::|:.|:|.. 
Zfish    13 IFGGIF-CLIMSFFETFNPGTHSEGHNHLHHHLKPVSKDELQKLSESQMSEFAMQVRVYCLIMV- 75

  Fly    60 YNSPDTAKYV------KRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFY 118
                 |.|.:      ..||.|||:..:|.:.:....|:  ...:...|.||.:::.:..|| ..
Zfish    76 -----TPKLLVHWATANDTWSKHCDKSVFYTSEASKALD--AVDLQEQDEWTRLRKAIQHAY-EN 132

  Fly   119 ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHES----FVHHHSGYVIS 179
            |..:.||....|::|.::|||:|::..:  .||||.|.|:      |.:|    :|.:.||.|:|
Zfish   133 AGDLHWFFIARPTTFAIIENLKYLVLDK--DPSQPFYIGH------TEKSGELDYVEYDSGIVLS 189

  Fly   180 REALRRYTMASKDPENKECTH-----WEGYVEGLDIHRCLRFANVTV-----AESRDEFEHETFL 234
            .||:||.....||.:  :|..     |: ..|...:..||:::.|..     |:.:..|..::..
Zfish   190 YEAMRRLMEVFKDED--KCPERGRALWK-MSEEKQLATCLKYSGVFAENGEDAQGKGLFNKKSVS 251

  Fly   235 PVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 299
            .:..|....|..|.:              ....|..||.|....|.::....|.||||:.:|...
Zfish   252 SLISDSISQNPGDVV--------------EACCSDMAITFAGMSPSQIQVLMYGVYRLRPYGHDF 302

  Fly   300 RNSIDFRP 307
            .:|:.|.|
Zfish   303 HDSLTFLP 310



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.