DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001025204.1 Gene:C1galt1c1 / 302499 RGDID:1311230 Length:316 Species:Rattus norvegicus


Alignment Length:312 Identity:78/312 - (25%)
Similarity:126/312 - (40%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 INVSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYNYNSPDTAKYVKRTWGKHC---------NVL 80
            :.:||.:|....:|.|           :.|::............||.||.|||         ||.
  Rat    51 LKISETERMELSKSFQ-----------VYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVK 104

  Fly    81 LFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHK 145
            :|.|.::|           :.|.|.::::....||..|.||.:||....|::|.|:|||:|.:.:
  Rat   105 VFESINMD-----------TNDMWLMMRKAYKYAYDKYKDQYNWFFLARPTTFAVIENLKYFLLR 158

  Fly   146 RKYQPSQPIYFGY-----ELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYV 205
            :  .||||.|.|:     :||       :|....|.|:|.|:::|.......||  :|....|.:
  Rat   159 K--DPSQPFYLGHTVKSGDLE-------YVSVDGGIVLSIESMKRLNGLLSVPE--KCPEQGGMI 212

  Fly   206 ----EGLDIHRCLRFA-----NVTVAESRDEFEHET---FLPVTM---DYQFLNGYDTIPWLRKL 255
                |...:..||::|     |...|:.:|.|..::   |:...|   ..|.:.|.         
  Rat   213 WKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQPNQVVEGC--------- 268

  Fly   256 SYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSIDFRP 307
                       .|..|:.|....|.:|:...|.||||:.||....:::.|.|
  Rat   269 -----------CSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLP 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.